SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009203 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009203
Domain Number 1 Region: 2-220
Classification Level Classification E-value
Superfamily HAD-like 5.77e-45
Family NagD-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009203   Gene: ENSGGOG00000009416   Transcript: ENSGGOT00000009457
Sequence length 229
Comment pep:novel chromosome:gorGor3.1:10:138374355:138508799:1 gene:ENSGGOG00000009416 transcript:ENSGGOT00000009457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLKRSRLKVRFCTNESQKSRAELVGQLRRLGFDISEGEVTAPAPAACQILKERGLRPYLL
IHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELENPVLISLGKGRYYKE
TSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVG
GAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK
Download sequence
Identical sequences ENSGGOP00000009203 ENSGGOP00000009203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]