SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009260 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009260
Domain Number 1 Region: 406-602
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009260   Gene: ENSGGOG00000009476   Transcript: ENSGGOT00000009519
Sequence length 974
Comment pep:novel chromosome:gorGor3.1:X:11000048:11542481:-1 gene:ENSGGOG00000009476 transcript:ENSGGOT00000009519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGGGEAGAEGSARGP
TAGRLYTPSLPAESLGPRLASSPRGPPPRATRLPPPGPLCSSFSTPSTPQEKSPSGSFHF
DYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQ
SPPDSRGHPYVVWKSEGDFTWNSMSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDCD
LSCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAFGMPLSQVIANDRAYKLKQDL
QRDEQKDASDFVASLLPFGNKRQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARRRG
AMSVDSITDLDDNQSRLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQH
LEKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLRDMPDPL
LTRELYTAFINTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVARHADDNISKD
GQEVTGNKMTSLNLATIFGPNLLHKQKSSDKEFSVQSSARAEESTAIIAVVQKMIENYEA
LFMVPPDLQNEVLISLLETDPDVVDYLLRRKASQSSSPDMLQSEVSFSVGGRHSSTDSNK
ASSGDISPYDNNSPVLSERSLLAMQEDAAPGGSEKLYKVPGQFMLVGHLSSSKSRESSPG
PRLGKDLSEEPFNIWGTWHSTLKSGSKDPGMTGSSGDIFESSSLRAGPCSLSQGNLSPNW
PRWQGSPAELDSDTQGARRTQAAAPATDGRAHPAVSRACSTPHVQVAGKAERPTARSEQY
LTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPYPGPGKPAAAASRIQGP
PESVGTATDQGGQAAEREQQVTQKKLSSANSLPAAEQDSPRLGDAGWLDWQRERWQIWEL
LSTDNPDALPETLV
Download sequence
Identical sequences ENSGGOP00000009260 ENSGGOP00000009260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]