SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009353 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009353
Domain Number 1 Region: 332-410
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.45e-25
Family Intermediate filament protein, coiled coil region 0.00000687
Further Details:      
 
Domain Number 2 Region: 105-142
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000012
Family Intermediate filament protein, coiled coil region 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009353
Domain Number - Region: 155-245
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009353   Gene: ENSGGOG00000009576   Transcript: ENSGGOT00000009615
Sequence length 470
Comment pep:novel chromosome:gorGor3.1:10:17720995:17729333:1 gene:ENSGGOG00000009576 transcript:ENSGGOT00000009615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAAMSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASS
PGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFAN
YIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERD
NLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKK
LHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFA
DLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAA
NYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLP
NFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
Download sequence
Identical sequences ENSGGOP00000009353 ENSGGOP00000009353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]