SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009462 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009462
Domain Number 1 Region: 569-709
Classification Level Classification E-value
Superfamily PH domain-like 9.02e-47
Family Phosphotyrosine-binding domain (PTB) 0.0000173
Further Details:      
 
Domain Number 2 Region: 425-555
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-21
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009462   Gene: ENSGGOG00000009684   Transcript: ENSGGOT00000009727
Sequence length 714
Comment pep:novel chromosome:gorGor3.1:5:43633879:43659655:1 gene:ENSGGOG00000009684 transcript:ENSGGOT00000009727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCM
GPPGRLQQAPQAEAKATCFLPSPGEQALGTPEDLDSYIDFSLESLNQMILELDPTFQLLP
PGTGGSQAELAQSTMSMRKKEEPEALDIKYIEVTSARSRCHDGPQHCSSPSVTPPFGSPC
SGGLLSRDVPRETRSSSESLIFSGNQGRGHQRPLPPLEGLSPRPPNSPSISIPCMGSKAS
SPHGLGSPLVASPRLEKRLGGLAPQRGSRISVLSASPVSDVSYMFGSSQSLLHSSNSSHQ
SSSRSLESPANSSSSLHSLGSVSLCMRPSDFQAPRNPTLTMGQPRTPHSPPLAKEHASSC
PPSITNSMVDIPIVLINGCPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSHSQTLSD
APFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRG
SFGLALRVQEVPASAQNRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQH
SIMALALPCKLTIPQRELGGADGASDSTDSPASCQKKSAGCHTLYLSSVSVETLTGALAV
QKAISTTFERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLTTLRFCGMDPEQRKW
QKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDMVQPASQVIGLVTALLQDAERM
Download sequence
Identical sequences G3R2K7
ENSGGOP00000009462 XP_004041819.1.27298 ENSGGOP00000009462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]