SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009482 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009482
Domain Number 1 Region: 318-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.38e-20
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 84-118
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000523
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009482
Domain Number - Region: 130-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009482   Gene: ENSGGOG00000009707   Transcript: ENSGGOT00000009747
Sequence length 464
Comment pep:novel chromosome:gorGor3.1:5:43327992:43335769:1 gene:ENSGGOG00000009707 transcript:ENSGGOT00000009747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSGACGGSVAGSEFSCALGGGLGSVPGGS
HAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKG
WYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYE
NELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAG
GNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAAT
SARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIRALEEQLH
QVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLS
KTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
Download sequence
Identical sequences G3R2M5
ENSGGOP00000009482 ENSGGOP00000009482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]