SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009570 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009570
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily vWA-like 5.98e-54
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 237-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 194-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000211
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 369-407
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000471
Family Chicken cartilage matrix protein 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009570   Gene: ENSGGOG00000009798   Transcript: ENSGGOT00000009836
Sequence length 413
Comment pep:novel chromosome:gorGor3.1:2a:20266532:20280554:-1 gene:ENSGGOG00000009798 transcript:ENSGGOT00000009836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKI
EFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAII
VTDGRPQDQVNEVAARAQASGIELYAVGVDRADMESLKMMASEPLEEHVFYVETYGVIEK
LSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDKCALN
THGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHC
ECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSAI
EEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKLKVNEYGQIHR
Download sequence
Identical sequences ENSGGOP00000009570 ENSGGOP00000009570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]