SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009650 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009650
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily Aquaporin-like 1.31e-71
Family Aquaporin-like 0.00000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009650   Gene: ENSGGOG00000009877   Transcript: ENSGGOT00000009917
Sequence length 269
Comment pep:novel chromosome:gorGor3.1:7:31299912:31313505:1 gene:ENSGGOG00000009877 transcript:ENSGGOT00000009917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLT
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGAALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
Download sequence
Identical sequences ENSGGOP00000009650 ENSGGOP00000009650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]