SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009656 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009656
Domain Number 1 Region: 27-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-24
Family Growth factor receptor domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 172-255
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.29e-23
Family Thyroglobulin type-1 domain 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009656   Gene: ENSGGOG00000009883   Transcript: ENSGGOT00000009923
Sequence length 261
Comment pep:novel chromosome:gorGor3.1:5:43676315:43690522:-1 gene:ENSGGOG00000009883 transcript:ENSGGOT00000009923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAVMLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCA
TCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSD
KDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSE
LHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKL
PGGLEPKGELDCHQLADSFRE
Download sequence
Identical sequences ENSGGOP00000009656 ENSGGOP00000009656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]