SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009786 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009786
Domain Number 1 Region: 633-919
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-81
Family Protein kinases, catalytic subunit 0.00000000333
Further Details:      
 
Domain Number 2 Region: 33-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.95e-69
Family Ephrin receptor ligand binding domain 0.00000187
Further Details:      
 
Domain Number 3 Region: 328-540
Classification Level Classification E-value
Superfamily Fibronectin type III 6.82e-39
Family Fibronectin type III 0.00000307
Further Details:      
 
Domain Number 4 Region: 939-1006
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.3e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009786
Domain Number - Region: 257-325,366-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00243
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009786   Gene: ENSGGOG00000010020   Transcript: ENSGGOT00000010066
Sequence length 1010
Comment pep:novel chromosome:gorGor3.1:1:23313062:23360663:1 gene:ENSGGOG00000010020 transcript:ENSGGOT00000010066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRARGCLPPALWVVTAAAAAATCVSPAKPLLNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSSTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAGLAAPAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEI
KYYEKDKEMQSYSTLKAVTTRATISGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPR
PRYDTRTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFL
PLHHPPGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLR
VPGQRDVPVAIKALKAGYTERQRQDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEY
MENGSLDAFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCK
VSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYG
ERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDAL
IRSPESLRATATVSRCPPPAFARSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGG
YSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences ENSGGOP00000009786 ENSGGOP00000019708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]