SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009821 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009821
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1017-1127
Classification Level Classification E-value
Superfamily E set domains 3.38e-36
Family Filamin repeat (rod domain) 0.000000684
Further Details:      
 
Domain Number 3 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 1.67e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 4 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 1.47e-31
Family Filamin repeat (rod domain) 0.000000834
Further Details:      
 
Domain Number 5 Region: 1398-1461,1493-1546
Classification Level Classification E-value
Superfamily E set domains 6.42e-31
Family Filamin repeat (rod domain) 0.00000627
Further Details:      
 
Domain Number 6 Region: 1623-1738
Classification Level Classification E-value
Superfamily E set domains 6.67e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 7 Region: 430-546
Classification Level Classification E-value
Superfamily E set domains 1.85e-30
Family Filamin repeat (rod domain) 0.00061
Further Details:      
 
Domain Number 8 Region: 527-639
Classification Level Classification E-value
Superfamily E set domains 8.01e-30
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 9 Region: 1536-1640
Classification Level Classification E-value
Superfamily E set domains 3.6e-29
Family Filamin repeat (rod domain) 0.0000246
Further Details:      
 
Domain Number 10 Region: 720-843
Classification Level Classification E-value
Superfamily E set domains 6.67e-29
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 11 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 1.53e-28
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 12 Region: 1848-1943
Classification Level Classification E-value
Superfamily E set domains 2.07e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 13 Region: 643-752
Classification Level Classification E-value
Superfamily E set domains 2.94e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 14 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 5.6e-27
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 15 Region: 2029-2124
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 16 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 17 Region: 2222-2315
Classification Level Classification E-value
Superfamily E set domains 2.07e-26
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 18 Region: 2542-2632
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 19 Region: 2413-2504
Classification Level Classification E-value
Superfamily E set domains 1.8e-24
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 20 Region: 2320-2411
Classification Level Classification E-value
Superfamily E set domains 5.74e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 21 Region: 352-448
Classification Level Classification E-value
Superfamily E set domains 8.15e-24
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 22 Region: 2141-2236
Classification Level Classification E-value
Superfamily E set domains 6.67e-21
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 23 Region: 946-1034
Classification Level Classification E-value
Superfamily E set domains 9.34e-20
Family Filamin repeat (rod domain) 0.0034
Further Details:      
 
Domain Number 24 Region: 1939-2027
Classification Level Classification E-value
Superfamily E set domains 6.01e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1787-1862
Classification Level Classification E-value
Superfamily E set domains 3.2e-16
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009821   Gene: ENSGGOG00000010039   Transcript: ENSGGOT00000010103
Sequence length 2633
Comment pep:novel chromosome:gorGor3.1:3:59472424:59653366:1 gene:ENSGGOG00000010039 transcript:ENSGGOT00000010103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTIKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPTSPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPFPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTIDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSS
YGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
TAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDM
SAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYLVPIIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences G3RYC3
ENSGGOP00000009821 ENSGGOP00000020810 XP_004034418.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]