SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009883 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009883
Domain Number 1 Region: 8-244
Classification Level Classification E-value
Superfamily HAD-like 3.89e-68
Family Predicted hydrolases Cof 0.000000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009883   Gene: ENSGGOG00000010124   Transcript: ENSGGOT00000010167
Sequence length 246
Comment pep:novel chromosome:gorGor3.1:16:9175656:9229890:1 gene:ENSGGOG00000010124 transcript:ENSGGOT00000010167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDV
VEKYDYVFPENGLVAYKDGKLLCKQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFI
EFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISF
DVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYSVTAPEDTRRI
CEMLFS
Download sequence
Identical sequences G3R3Q1
ENSGGOP00000009883 XP_004057223.1.27298 ENSGGOP00000009883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]