SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009886 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009886
Domain Number 1 Region: 2-280
Classification Level Classification E-value
Superfamily HAD-like 9.83e-81
Family Pyrimidine 5'-nucleotidase (UMPH-1) 0.0000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009886   Gene: ENSGGOG00000010128   Transcript: ENSGGOT00000010170
Sequence length 292
Comment pep:novel chromosome:gorGor3.1:5:42227046:42241402:1 gene:ENSGGOG00000010128 transcript:ENSGGOT00000010170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFSYNGKRCPSSYNILDNSKI
ISEECRKELTALLHHYYPIEIDPHQTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVR
ESNAMLREGYKTFFNTLYHNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNE
DGFLQGFKGQLIHTYNKNSSACENSGYFQQLEGKTNVILLGDSIGDLTMADGVPGVQNIL
KIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILCQGVQLEMQGP
Download sequence
Identical sequences ENSGGOP00000009886 ENSGGOP00000009886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]