SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009953 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009953
Domain Number 1 Region: 11-248
Classification Level Classification E-value
Superfamily L domain-like 8.16e-41
Family Internalin LRR domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009953   Gene: ENSGGOG00000010204   Transcript: ENSGGOT00000010241
Sequence length 347
Comment pep:novel chromosome:gorGor3.1:8:89908947:90040526:1 gene:ENSGGOG00000010204 transcript:ENSGGOT00000010241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERLLIKALSGGKNTKIITLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPELCNLT
QLTTLNLGNNLLEEVPEEMKYLTSLKNLHLSGNRICRFAPGACDGLQNLILLNLNNNHLT
QLPQEVSRLKSLTYMSINYNQLASIPRELCFLENLVELQLNYNQLICIPEKIKFLKKLQK
LLLARNNIGVLPEELCDLKKLRILDIAGNIIQIFPSGFQDLKLREFYCEGNPLFLQQPVI
STQQENVWSLQEITSRFVMNQLAENNPFLMDGIERYPQVRSMISQGKTCAICGQYFITVW
LECVRFVPPPKDWKISKNLKLVPLQVLICSYKCFTQRDPNLFGIAQV
Download sequence
Identical sequences G3R3X0
XP_018888475.1.27298 ENSGGOP00000009953 ENSGGOP00000009953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]