SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009982 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009982
Domain Number 1 Region: 216-335
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-28
Family SH2 domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009982   Gene: ENSGGOG00000010231   Transcript: ENSGGOT00000010270
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:19:4382703:4391342:1 gene:ENSGGOG00000010231 transcript:ENSGGOT00000010270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAENRLEPDPAGP
GDSKNPGDAKYGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYSDPFDAQPHPAPPD
DGYMEPYDAQWVMSELPGRGVQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADE
YDQPWEWKKDHISRAFAVQFDSPEWERTPGSAKELRRPPPRSPQPAERVDPALPLEKQPW
FHGPLNRADAESLLSLCKEGSYLVRLSETSHQDCSLSLRSSQGFLHLKFARTRENQVVLG
QHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP
Download sequence
Identical sequences G3R3Z7
ENSGGOP00000009982 ENSGGOP00000009982 XP_004059819.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]