SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010143 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010143
Domain Number 1 Region: 274-624
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-84
Family p120GAP domain-like 0.0000334
Further Details:      
 
Domain Number 2 Region: 580-722
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-33
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 125-265
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-29
Family Synaptotagmin-like (S variant) 0.0055
Further Details:      
 
Domain Number 4 Region: 18-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.73e-26
Family PLC-like (P variant) 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010143   Gene: ENSGGOG00000010388   Transcript: ENSGGOT00000010439
Sequence length 818
Comment pep:novel chromosome:gorGor3.1:12:112703851:112739011:-1 gene:ENSGGOG00000010388 transcript:ENSGGOT00000010439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APFCLESLWLGAMAKSSSLNVRVVEGRALPAKDVSGSSDPYCLVKVDDEVVARTATVWRS
LGPFWGEEYTVHLPLDFHQLAFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLS
RVDPDAEVQGEICLSVQMLEDGQGRCLRCHVLQARDLAPRDISGTSDPFARVFWGSQSLE
TSTIKKTRFPHWDEVLELREMPGAPSPLRVELWDWDMVGKNDFLGMVEFSPKTLQQKPPN
GWFRLLPFPRAEEDSGGNLGALRVKVRLIEDRVLPSQCYQPLMELLMESLQGPAEEDTAS
PLALLEELTLGDCRQDLATKLVKLFLGRGLAGRFLDYLTRREVARTMDPNTLFRSNSLAS
KSMEQFMKLVGMPYLHEVLKTVISRVFEEKKYMELDPCKMDLGRTRRISFKGALSEEQMR
ETSLGLLTGYLGPIVDAIVGSVGRCPPAMRLAFKQLHRRVEERFPQAEHQQDVKYLAISG
FLFLRFFAPAILTPKLFDLRDQHADPQTSRSLLLLAKAVQSIGNLGQQLGQGKELWMAPL
HPFLLQCVSRVRDFLDRLVDVDGDEEAGVPARALFPPSAIVREGYLLKRKEEPAGLATRF
AFKKRYVWLSGETLSFSKSPEWQMRHSITVSHIRAVERVDEGAFQLPHVMQVVTQDGTGA
LHTTYLQCKNVNELNQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERSAAGCSR
THSAVTLGDWSDPLDPDAEAQTVYRQLLLGRDQLRLKLLEDSNMDTTLEADTGACPEVLA
RQRAATARLLEVLADLDRAHEEFQQQEQGKAALGPLGP
Download sequence
Identical sequences ENSGGOP00000010143 ENSGGOP00000010143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]