SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010155 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010155
Domain Number 1 Region: 875-985
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000367
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010155   Gene: ENSGGOG00000010399   Transcript: ENSGGOT00000010451
Sequence length 1124
Comment pep:novel chromosome:gorGor3.1:1:152781790:152888336:-1 gene:ENSGGOG00000010399 transcript:ENSGGOT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYFWAQNESNRPDLLCGQPADYLVEEKHFTTLVCFIVVLGGLLKMCLKNSEVIVLTIL
SLSGFVIGHMAYNSVEVHQIVYPLLRTSSFSLYSYFSPLIIFMVALDLEFYTLKKMFWQV
LLTGLISFSTASIIIGYVVIKFNKDSWDLQSCLLFSITLGIIDPLRSVNSLKTIGISKIY
IDLIRGESLIICSIASIFFGNFRGNRIHFSIFRDLHVGIELSYDILGSIIFGYWCAKIIQ
CILADVFSNMLTNIILCFSMVYMTFYIVEFLGMSGTLALAAVGLNLDSLTFKPKIELVIT
KFLRIFSSVYEHLIYAFFGIVIGCGELSHYEFYTIPFIFILFTTVNLVRLLTILLVSPIL
MHSNYEYNWRWGVVITWSGIKGVFNLLWAPDVYNLAERKVEVPQMFILYVQVISLLTMGI
NSYVMTQSARKLDLCVLSLPRQMILQNATQHIQEIVQNTITLFKTEKILTNVNWTLVEDK
TRIEYIPFSHVSHNDMKTESTTDEALMEEARLHVAAVQMSSFEKQRNNGILEIEAARILI
GAAKCYYSIQGKFMSIYDVSTYMRTRSWLIKFKNVLTFLEYCIEKIHFIPPESNTFLTFI
FHIVFSEEFEYTGQIINLIYIYPMIIHLWPMARGLNVSALISINYYFMFLYVLESTLKII
ILKRKYFQQCWNTLEFFILVIGIIDIFCVYFVKLRPDNLALIELTVIMGYLRIIRFLPLF
KIIVPILTRIADVQIKKRLSLMYSITKGYIKSQEDAKLLIKQIAVCESIYQKLCEILETN
KQDAVKELVLMEHEGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHEVIEINKVL
LKKLKALNNFPKAIPPPTPDIYLHNIIWLEGKDVLIDFFKERAKLACFDSGDTICKAGEM
PQGIYLIISGMAILHSFSPTFGTESSQRRDRRSRVMFTEFCTTGDIIGELSCLLKREIEY
TVICETSLQACFISLEDLYEGFDAFWPSLEYKIWLKLALSTAYQYFESSLIDEDLRFQNC
VMFNQAYVETLSSYSDMTIDNMTMKFVIIVYGSVIDTKTEEPYFAPCIIPTTCEQVQGTS
DLSKLLIIQASELTRRNSNTNVMASVNMVFEPPGKNINGRQKMS
Download sequence
Identical sequences G3R4F4
ENSGGOP00000010155 ENSGGOP00000010155 XP_004027964.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]