SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010181 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010181
Domain Number 1 Region: 40-373
Classification Level Classification E-value
Superfamily L domain-like 3.29e-60
Family Ngr ectodomain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 426-516
Classification Level Classification E-value
Superfamily Immunoglobulin 2.73e-18
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010181   Gene: ENSGGOG00000010438   Transcript: ENSGGOT00000010478
Sequence length 614
Comment pep:novel chromosome:gorGor3.1:15:57292152:57313237:-1 gene:ENSGGOG00000010438 transcript:ENSGGOT00000010478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVP
EGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGL
RSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRA
FSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEI
SHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSM
LHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLETLIL
DSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRARI
RDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRY
AQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRA
TVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGI
SSADAPRKFNMKMI
Download sequence
Identical sequences A0A2J8KSL1 A0A2J8RQN6
NP_001288115.1.87134 NP_001288115.1.92137 NP_001288116.1.87134 NP_001288116.1.92137 NP_001288118.1.87134 NP_001288118.1.92137 NP_001288120.1.87134 NP_001288120.1.92137 NP_001288121.1.87134 NP_001288121.1.92137 NP_001288123.1.87134 NP_001288123.1.92137 NP_001288124.1.87134 NP_001288124.1.92137 NP_001288126.1.87134 NP_001288126.1.92137 NP_001288127.1.87134 NP_001288127.1.92137 NP_001288128.1.87134 NP_001288128.1.92137 NP_001288129.1.87134 NP_001288129.1.92137 XP_008961739.1.60992 XP_008961740.1.60992 XP_008961741.1.60992 XP_008961742.1.60992 XP_008961743.1.60992 XP_009427900.1.37143 XP_009427901.1.37143 XP_011520420.1.92137 XP_016782748.1.37143 XP_016782749.1.37143 XP_016878171.1.92137 XP_018866816.1.27298 ENSP00000453853 ENSGGOP00000010181 ENSGGOP00000010181 ENSP00000453853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]