SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010210 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010210
Domain Number 1 Region: 508-674,754-868
Classification Level Classification E-value
Superfamily L domain-like 2.21e-50
Family Ngr ectodomain-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 278-485
Classification Level Classification E-value
Superfamily L domain-like 1.83e-40
Family Ngr ectodomain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 32-263
Classification Level Classification E-value
Superfamily L domain-like 4.37e-39
Family Ngr ectodomain-like 0.00075
Further Details:      
 
Domain Number 4 Region: 1142-1332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.15e-39
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 5 Region: 997-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000783
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 1028-1156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000471
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 955-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000327
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 912-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000348
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 1369-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 1416-1444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010210
Domain Number - Region: 1335-1366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00281
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010210   Gene: ENSGGOG00000010444   Transcript: ENSGGOT00000010509
Sequence length 1523
Comment pep:novel chromosome:gorGor3.1:5:153106722:153743237:-1 gene:ENSGGOG00000010444 transcript:ENSGGOT00000010509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLFYKLAYYIPIPRKAFWFIKIAPPRQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
LCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLN
DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
FRGLSGLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNDESSCQ
LSPRCPEQCTCMETVVRCSNKGLRALPKGMPKDVTELYLEGNHLTAVPRELSTLRHLTLI
DLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPT
HRFQCKXPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCI
QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQQCEINPDDCEDNDCENNATCVDGINNYVC
ICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFRCECVPGYSGKLCETDNDDCVA
HKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK
SLGKLQKQPTVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECHSGWTGPLCDQEARDPCLSHSCNHG
KCVATGTSYMCKCAEGYGGALCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSG
EHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQ
CTDGSSFVEEVERHLECGCLACS
Download sequence
Identical sequences ENSGGOP00000010210 ENSGGOP00000023288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]