SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010217 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010217
Domain Number 1 Region: 16-142
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.13e-28
Family Canonical RBD 0.00000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010217   Gene: ENSGGOG00000010478   Transcript: ENSGGOT00000010516
Sequence length 199
Comment pep:novel chromosome:gorGor3.1:8:80876692:80877450:-1 gene:ENSGGOG00000010478 transcript:ENSGGOT00000010516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAAMNARPHKVDGRVVEPKRAISREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQY
GKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYYTVNGHNCEVRKALSKQEMAS
ASSSQRGRSGSGNFGGGSYKDFGNYNNQSSNFGPMKGGNFGGRSSGPCGGGGQYFAKPRN
QGGYGGSSSSSSYGSGRRF
Download sequence
Identical sequences ENSGGOP00000010217 ENSGGOP00000010217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]