SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010219 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010219
Domain Number 1 Region: 30-260
Classification Level Classification E-value
Superfamily Aquaporin-like 1.44e-71
Family Aquaporin-like 0.000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010219   Gene: ENSGGOG00000010474   Transcript: ENSGGOT00000010518
Sequence length 323
Comment pep:novel chromosome:gorGor3.1:18:23943590:23959833:-1 gene:ENSGGOG00000010474 transcript:ENSGGOT00000010518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDRPTARRWGKCGPLCTRENIMVAFRGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWG
GTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIA
AQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDS
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAGGLYEYVFCPDVELKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
VIDIDRGEEKKGKDQSGEVLSSV
Download sequence
Identical sequences A0A0D9RZ01 A0A1D5RFU8 A0A2K5I5P7 A0A2K5NVA4 A0A2K6A5T4 G3R4L3 G7PWJ7
ENSGGOP00000010219 ENSMMUP00000019590 ENSGGOP00000010219 NP_001244600.1.72884 XP_004059320.1.27298 XP_005587045.1.63531 XP_007972575.1.81039 XP_011794684.1.43180 XP_011843430.1.47321 XP_011930288.1.92194 9544.ENSMMUP00000019590 ENSMMUP00000019590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]