SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010285 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010285
Domain Number 1 Region: 392-601
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000817
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000010285
Domain Number - Region: 263-382
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00108
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010285   Gene: ENSGGOG00000010548   Transcript: ENSGGOT00000010589
Sequence length 735
Comment pep:novel chromosome:gorGor3.1:19:15391560:15399111:1 gene:ENSGGOG00000010548 transcript:ENSGGOT00000010589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLLRKTFSRLRGREKLPRKKSDAKERGRPAQRPEPSPPEPEPQAPEGSQAGAEGPSS
PEASRSPARGAYLQSLEPSSRRWVLGGAKPAEDTSLGPGVPGSGEPTGEIWYNPIPEEDP
RPPAPEPPGPQPGSAESEGLAPQGAAPASPPTKASRTKSPGPARRLSIKMKKLPELRRRL
SLRGPRAGRERERAAPAGSVISRYHLDSSVGGPGPAAGPGGTRSPRAGYLSDGDSPERPA
GPPSPTSFLPYEVGPTARAPPAALWGRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEAR
ARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGC
QAQQLAVRLEPQGLLYAKLTLSEQQEAPATAEPRVFGLPLPLLVERERPPGQVPLIIQKC
VGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLR
ELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVS
SFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSW
PDPRLPRQSPDVAPYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGR
DFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALI
LDLERELSKQINVCL
Download sequence
Identical sequences G3R4S4
XP_004060240.1.27298 ENSGGOP00000010285 ENSGGOP00000010285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]