SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010383 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010383
Domain Number 1 Region: 35-118
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.57e-27
Family MHC antigen-recognition domain 0.0000823
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-25
Family C1 set domains (antibody constant domain-like) 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010383   Gene: ENSGGOG00000010653   Transcript: ENSGGOT00000010688
Sequence length 256
Comment pep:novel chromosome:gorGor3.1:6:33966807:33970015:-1 gene:ENSGGOG00000010653 transcript:ENSGGOT00000010688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKHQSVMALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDG
EQLFSVDLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPR
VTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDNLFRKF
HYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLV
GTVLIIMGTYVSSVPR
Download sequence
Identical sequences ENSGGOP00000010383 ENSGGOP00000010383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]