SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010388 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010388
Domain Number 1 Region: 50-249
Classification Level Classification E-value
Superfamily L domain-like 3.74e-40
Family Ngr ectodomain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010388   Gene: ENSGGOG00000010655   Transcript: ENSGGOT00000010693
Sequence length 370
Comment pep:novel chromosome:gorGor3.1:12:1829888:1846345:1 gene:ENSGGOG00000010655 transcript:ENSGGOT00000010693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPGSSPEQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLT
TVPPDVPAATRTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTE
LQLRNNSIRTLDRDLLRRSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLD
RLTFEPLANLQLLQVGDNPWECDCNLREFKHWMEWFSYRGGRLDQLACTLPKELRGKDMR
MVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKPGAEPQPEPSTACPQKQRHR
PASVRRAMGTVIIAGAVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQPLMGDPEGEH
EDQKQISSVA
Download sequence
Identical sequences G3R521
ENSGGOP00000010388 XP_004052546.1.27298 XP_018894444.1.27298 ENSGGOP00000010388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]