SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010446 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010446
Domain Number 1 Region: 149-235
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-26
Family Thyroglobulin type-1 domain 0.00000386
Further Details:      
 
Domain Number 2 Region: 32-89
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000502
Family Growth factor receptor domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010446   Gene: ENSGGOG00000010713   Transcript: ENSGGOT00000010753
Sequence length 238
Comment pep:novel chromosome:gorGor3.1:7:46951730:46956747:1 gene:ENSGGOG00000010713 transcript:ENSGGOT00000010753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCXRSAGCGCCPMCALPLGAACGVATARCARG
LSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLM
APSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRMELYRVVESLAKAQETSGEEISKF
YLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQMYFNVQN
Download sequence
Identical sequences ENSGGOP00000010446 ENSGGOP00000010446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]