SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010530 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010530
Domain Number 1 Region: 402-469
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 547-673
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 1180-1242
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 4 Region: 670-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-16
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 5 Region: 1344-1407
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 6 Region: 768-834,861-924
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 881-1003
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 1536-1619
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000471
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 355-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 991-1091
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000121
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 286-352
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000562
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 12 Region: 834-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000059
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 13 Region: 1287-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1252-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1084-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 156-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000404
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010530   Gene: ENSGGOG00000010783   Transcript: ENSGGOT00000010839
Sequence length 1624
Comment pep:novel chromosome:gorGor3.1:19:38025441:38057715:1 gene:ENSGGOG00000010783 transcript:ENSGGOT00000010839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPGTSGRRPLLLVLLLPLFAAATSAASPSPSPSQVIEVPGVPSRPASVAVCRCCPGQT
SRRSRCIRAFCRVRSCQPKKCAGPQRCLNPVPAVPSPSPSVRKRQVSLNWQPLTLQEARA
LLKRRRPRGPGGRGLLRRRPPQRAPAGKAPVLCPLICHNGGVCVKPDRCLCPPDFAGKFC
QLHSSGARPPAPAIPGLTRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVERV
SGPWEEADAEAVARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGGECAS
PLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERVSAPDGPCPTGFERVNGSCEDVDE
CATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGCSL
PILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLG
QEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPRPDPRPGPELPLPSIPAWTGPEIP
ESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAP
GRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGY
QAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPP
CGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCP
MGFQPNAAGSECEDVDECENHLACPGQECVNSPGSFQCRACPSGHHLHRGRCTDVDECSS
GAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGS
FACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCL
DVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQ
RCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGY
EGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRTSAG
TFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAPDACDNILARN
VTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLF
RDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYH
CTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCLYG
EAWGMDCALCPAQDSDDFEALCNVLRPPAYSPPRPGGFGLPYEYGPDLGPPYQGLPYGPE
LYPPPALPYDPYPPPPGPFARREAPYGAPRFDMPDFEDDGGPYGESEAPAPPGPGTRWPY
RSRDTRRSFPEPEEPPEGGSYAGSLAEPYEELEAEECGILDGCTNGRCVRVPEGFTCRCF
DGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRCICRPGFAPTHQPHHCAPA
RPRA
Download sequence
Identical sequences G3S458
ENSGGOP00000022860 ENSGGOP00000010530 XP_004060806.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]