SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010639 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010639
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.97e-33
Family Chaperone J-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010639   Gene: ENSGGOG00000010915   Transcript: ENSGGOT00000010956
Sequence length 277
Comment pep:novel chromosome:gorGor3.1:2b:108240359:108247937:1 gene:ENSGGOG00000010915 transcript:ENSGGOT00000010956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPADVF
Download sequence
Identical sequences A0A0D9R6W7 A0A2J8TUH2 A0A2K5I143 A0A2K5P8B0 A0A2K5WV59 A0A2K5XLE1 A0A2K6D514 A0A2K6JY66 A0A2K6NXY1 B0CM59 G3R5Q7 I0FRC7 K7BV97
ENSMMUP00000015748 gi|88501736|ref|NP_001034639.1| NP_001034639.1.87134 NP_001034639.1.92137 NP_001253510.1.72884 XP_002812938.1.23681 XP_003818703.1.60992 XP_007964564.1.81039 XP_010358605.1.97406 XP_011739048.1.29376 XP_011787592.1.43180 XP_011820047.1.47321 XP_011918209.1.92194 XP_017712353.1.44346 XP_018877924.1.27298 ENSP00000375936 ENSPANP00000016633 ENSGGOP00000010639 ENSP00000375936 ENSGGOP00000010639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]