SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010675 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010675
Domain Number 1 Region: 157-244
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.33e-23
Family Ubiquitin-related 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010675   Gene: ENSGGOG00000010956   Transcript: ENSGGOT00000010993
Sequence length 309
Comment pep:novel chromosome:gorGor3.1:5:39810445:39908285:-1 gene:ENSGGOG00000010956 transcript:ENSGGOT00000010993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDPASSQAMELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSSSNQLLGAIVS
AGDTSVLHLGHVDHLVAGQGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGSGVEP
SLEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARP
EDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSLNITDNCVIHCHRSPPGPAVPGP
SASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPATVSLVGVTVFFS
FLVFGMYGR
Download sequence
Identical sequences ENSGGOP00000010675 ENSGGOP00000010675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]