SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010685 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010685
Domain Number 1 Region: 127-248
Classification Level Classification E-value
Superfamily SH2 domain 7e-25
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 252-291
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000445
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010685   Gene: ENSGGOG00000010961   Transcript: ENSGGOT00000011003
Sequence length 318
Comment pep:novel chromosome:gorGor3.1:5:45827756:45874163:-1 gene:ENSGGOG00000010961 transcript:ENSGGOT00000011003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHPPTPPPPPRRSLSLLDDIS
GTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRAAESLHSQPPQHLQCPLYRP
DSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGI
THHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPV
QLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLS
LKEAQLISKQKQEVEPST
Download sequence
Identical sequences ENSGGOP00000010685 ENSGGOP00000010685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]