SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010766 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010766
Domain Number 1 Region: 26-254
Classification Level Classification E-value
Superfamily Aquaporin-like 1.23e-60
Family Aquaporin-like 0.0000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010766   Gene: ENSGGOG00000011047   Transcript: ENSGGOT00000011087
Sequence length 261
Comment pep:novel chromosome:gorGor3.1:16:25927276:25940540:1 gene:ENSGGOG00000011047 transcript:ENSGGOT00000011087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEIAMCEPEFCNDKAREPSMGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENG
TDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLG
GMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEK
TKGPLAPFSIGFAVTVDILAGGSVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLL
VGLLIRCFIGDGKTRLILKAR
Download sequence
Identical sequences G3R630
XP_004057425.1.27298 ENSGGOP00000010766 ENSGGOP00000010766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]