SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010817 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010817
Domain Number 1 Region: 122-325
Classification Level Classification E-value
Superfamily L domain-like 1.85e-29
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010817   Gene: ENSGGOG00000011100   Transcript: ENSGGOT00000011138
Sequence length 414
Comment pep:novel chromosome:gorGor3.1:14:30404204:30420203:1 gene:ENSGGOG00000011100 transcript:ENSGGOT00000011138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRY
ELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKANSSSLKGFLSAMRLAHRGCNVDTPV
STLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLR
KLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKA
LPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLD
LFGNIFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCG
RFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK
Download sequence
Identical sequences G3R676
ENSGGOP00000010817 XP_004055177.1.27298 ENSGGOP00000010817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]