SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010826 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010826
Domain Number 1 Region: 902-1087
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 690-823
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-25
Family Pleckstrin-homology domain (PH domain) 0.0000369
Further Details:      
 
Domain Number 3 Region: 19-156
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-21
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010826   Gene: ENSGGOG00000011104   Transcript: ENSGGOT00000011147
Sequence length 1332
Comment pep:novel chromosome:gorGor3.1:5:45709500:45750200:-1 gene:ENSGGOG00000011104 transcript:ENSGGOT00000011147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRHRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEAR
SIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHL
DNSSLGMSQPRPSPGAFPHLSSEPRTPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRRA
GERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRATR
SAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYR
SYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPASFPPEASEPPRVVRPEPSTRALEP
PAEDRRDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPDPEAGGRGERLGRKVAPLATTE
DSLASIPFIDEPTSLSTDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQD
CSSIKAGRRSSYLLAITKERSKSCDDGLNTFRDEGRVLRCLPNRIPSLRLLRSFFTDGSL
DSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGSGLRQWKRVYA
ALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTT
ADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPKA
DSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKAAP
RAFGVRLEECQPATENQHAPLIVAACCRIVEAGLESTGFYRVPGNNAVVSSLQEQLNRGP
GDINLQDERWQDLNVISSLLKSFFRKKYNDFIEANRIEDVWERMRTLRKLIRDLPGHYYE
TLKFLVGHLKTIADHSEKNKIEPRNLALVFGPTMVRTSEDNMTDMVTHMPDCYKIMETLI
QHSDWFFSDQVQEDKAERAPVGDKELQAVPNIEYLLPNIGRTVPPGDLGSDSTTCSSAKS
KGSWAPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKPGAGATAPG
TQERPQGPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDRSVCSGASGRR
SGAGDEXXXXPPEPAGARAHSDNKDSGLSSLESTKARAPSSAASQPPAPGDTGSLQSQPP
RRSAASRLHQCL
Download sequence
Identical sequences ENSGGOP00000010826 ENSGGOP00000025971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]