SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010982 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010982
Domain Number 1 Region: 787-993
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.53e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000823
Further Details:      
 
Domain Number 2 Region: 296-578
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.53e-47
Family FCH domain 0.0089
Further Details:      
 
Domain Number 3 Region: 714-767
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010982   Gene: ENSGGOG00000011251   Transcript: ENSGGOT00000011306
Sequence length 1152
Comment pep:novel chromosome:gorGor3.1:19:1031572:1052135:1 gene:ENSGGOG00000011251 transcript:ENSGGOT00000011306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGQRVLKGLLGWVCTWTQAWRARLGARGCGLHVLCPRDLPLPPEELPRKDGADAVFPG
PSLEPPAGSSGIKATGTLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELS
TEGAGPDIVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRVMHQI
ISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMG
EVDSSTLLAVPPGDSSQSMESLYGPGSEGTPPSLDDCDAGCLPAEEVDVLLQRCEGGVDA
ALLYAKNMAKYMKDLISYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLAL
EQDLEFGHGMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRK
AKQGYTQRCEDHDKARFLVAKAEEEQAGTALGAGSTATKTLDKRRRLEEEAKNKAEEAMA
TYRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHF
QMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDV
ARPEAAGSPPEEGGCTEGTPAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFE
RTSSSGTMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHR
LRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFS
HAARSAPDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQA
SPHDISNVLKLYLRQLPEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVA
VAMAGRLRELLRDLPPENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPT
EATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVPYLEA
GEAVVYPLQEAAEDGCRESRVVSNDSDSDLEEASELLSSSEASALRRLSFLEQQQSEASL
EAASGSHSGSEEQLEATAREDGDRDEDGPAQQLSGFNTNQSNNVLQTPLPPVRLRGGRMT
LGSCRQRQPEFV
Download sequence
Identical sequences ENSGGOP00000010982 ENSGGOP00000010982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]