SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011024 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011024
Domain Number 1 Region: 350-674
Classification Level Classification E-value
Superfamily DNase I-like 1.96e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 1138-1200
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000359
Family SAM (sterile alpha motif) domain 0.0099
Further Details:      
 
Domain Number 3 Region: 1-61
Classification Level Classification E-value
Superfamily SH2 domain 0.000000482
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011024   Gene: ENSGGOG00000011295   Transcript: ENSGGOT00000011350
Sequence length 1202
Comment pep:novel chromosome:gorGor3.1:11:69125296:69136529:1 gene:ENSGGOG00000011295 transcript:ENSGGOT00000011350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLGIRYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLP
VEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPN
GLSTVSHEYLKGSYGLDLEAVRAGASHLPHLTRTLATSCRRLHSEVDKVLSGLEILSKVF
DQQSSPMVTRLLQQQNLPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPA
PQPSTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDW
TTFTHDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHS
KQDEPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQENSV
GDREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIAN
TLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLSLGDRQLNAFDIS
LRFTHLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEEIS
FPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTS
DHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEE
YKKSFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGE
CVVALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYGGDSTGKGYL
GASGQLHFISLLCIPGRSGSRKPAFTEASCPLSRLFEEPEKPPPTGRPPAPPRAAPREEP
LTPRLKPEGAPEPEGVVAPPPKNSFNNPAYYVLEGVPHQLLPLEPPSPARAPVPSATKNK
VAITVPAPQLGRHRPPRVGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLPGPV
VRGRGGGEARGPPPPKAHPRPPLPPGPSPASTFLGEVASGDDRSCSVLQMAKTLSEVDYA
PAGPARSVLLPGPLELQPPRGLPSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGL
GEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQL
SK
Download sequence
Identical sequences ENSGGOP00000011024 ENSGGOP00000023576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]