SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011035 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000011035
Domain Number - Region: 391-456
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000107
Family Intermediate filament protein, coiled coil region 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011035   Gene: ENSGGOG00000011321   Transcript: ENSGGOT00000011362
Sequence length 480
Comment pep:novel chromosome:gorGor3.1:1:33771172:33793784:-1 gene:ENSGGOG00000011321 transcript:ENSGGOT00000011362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPEPRRGGDGAAQAARKTRAEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILY
LEDTGDLDETLYVQETEKAEEALYIEEAMQPAEALHVEEPGNPEETVCVEETTEPDRIQF
VEGPVEPGKPTSPEQVVYEGETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQ
QCVQAVAQLEEERDQLIHELVLLREPALQEVQQVHQDILAAYKLHAQAELERDGLREEIR
LVKQKLFKVTKECVAYQYQLECRQQDVAQFADFREVLTTRATQLSEELAQLRDAYQKQEE
QLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQLLRLLERKEAGTKA
LQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER
QRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQG
Download sequence
Identical sequences ENSGGOP00000011035 ENSGGOP00000011035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]