SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011037 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011037
Domain Number 1 Region: 173-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-82
Family Protein kinases, catalytic subunit 0.000000188
Further Details:      
 
Domain Number 2 Region: 74-211
Classification Level Classification E-value
Superfamily SH2 domain 1.42e-33
Family SH2 domain 0.00000169
Further Details:      
 
Domain Number 3 Region: 12-95
Classification Level Classification E-value
Superfamily SH3-domain 3.21e-18
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011037   Gene: ENSGGOG00000011325   Transcript: ENSGGOT00000011364
Sequence length 451
Comment pep:novel chromosome:gorGor3.1:20:61773761:61782503:-1 gene:ENSGGOG00000011325 transcript:ENSGGOT00000011364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRDQTHLCPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRQLQAEGNAAGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT
Download sequence
Identical sequences G3R6S0
ENSGGOP00000011037 XP_004062576.1.27298 ENSGGOP00000011037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]