SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011046 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011046
Domain Number 1 Region: 222-487
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-75
Family Protein kinases, catalytic subunit 0.000000185
Further Details:      
 
Domain Number 2 Region: 118-252
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-34
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 3 Region: 39-167
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000735
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011046   Gene: ENSGGOG00000011330   Transcript: ENSGGOT00000011373
Sequence length 495
Comment pep:novel chromosome:gorGor3.1:20:61786068:61793213:-1 gene:ENSGGOG00000011330 transcript:ENSGGOT00000011373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRGMEPFLRRRLAFLSFFWDKIWPAGSEPDHGTPRSLDPNTDPVPTLPAEPCSPFPQLFL
ALYDFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSD
QPWYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADG
SLYLQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLG
EGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEP
VYIVTELMRKGNLQAFLGSPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVL
VDDGLACKVADFGLARLLKDNIYSPSSSSEIPVKWTVPEAANYRVFSQKSDVWSFGVLLY
EVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLR
EKLHAIHRCHPRVLT
Download sequence
Identical sequences ENSGGOP00000011046 ENSGGOP00000011046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]