SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011147 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011147
Domain Number 1 Region: 30-248
Classification Level Classification E-value
Superfamily L domain-like 6.38e-40
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011147   Gene: ENSGGOG00000011434   Transcript: ENSGGOT00000011475
Sequence length 1247
Comment pep:novel chromosome:gorGor3.1:1:76696700:76710172:-1 gene:ENSGGOG00000011434 transcript:ENSGGOT00000011475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLVAACPESCVVCTKDVTLCHQLTYIVAAPMTTRVLIITDGYLSSIESTNLSLLFNLA
LLSLSRNGIEDVQEDALHGLTMLRTLLLEHNQISSSSLTDHTFSKLHSLQVLVLSNNALR
TLQGSWFRNTSGLTRLQLDGNQITNLTDSSFGGTNLHSLRYLDLSNNFISYIGKDAFRPL
PQLQEVDLSRNRLAHMPDVFTPLKQLILLSLDKNQWSCTCDLHPLARFLRNYIKSSAHTL
RNAKDLNCQPSTAAVAAAQSVLRLSETNCDSKAPNFTLVLKDRSPLLPGPDVALLTVLGF
AGAVGLTCLGLVVFNWKLQQGKANEHTSENLCCRTFDEPLCAHEARNYHTKGYCNCHLTQ
ENEIKVMSIVGSRKEMPLLQENSHQATTASESATLDGSFRNLKKKDHGVGSTLFCQDGRL
LHSECSEPPGNTTAFNEAGLLTTYNPRKVQKLWNLEPGEVQPQTLQHHIIRTEDISSDIF
RRRYATPASALAGESLEKHLTNESWQPPIEKEDNGLHPHRQRHFITSSSSKPCEPEEHYV
QKIVQKHRSKYDDPCGLLKQSKPRYFQPNNSLICKYVPCEQFEDYMKEKKPNRRQHSKPE
KEQIQINSAIEKFLMSEDNIDLSGLSTKTKKAYSPKRVSFHDPDLVEINRSMMSPKISTP
WKRQKNQSNQLTKLDVKKFSNTGERNKGEKWFTNSWVLKRKRTPQSDLKGKIKGQKLKLN
LHPFRKVRVHPEKSLSGLPKQCKQVLLPPKKLSKTSETKAKMNTVSSADFLQQSESSNYV
RLTSKRLPLKHDSKQTPYYQRNTKRAPLLSANNLSVVNQSSIESSCYSAGHIPDGNTSKL
PQPTPTDAEHRHSHSQFSAEQMEDATQLESKVLSYLPTTWENTGSDVLPFQHSRGATDQG
TTESTEHMGQNVSKTSELNQFSLSPRNQTQLLDAHKTDSYNKEYTLDQNEALQHREQNSS
HAQLENKEKTLMTKPQIPHQIVEDCIMDKEENDVEKKLSKTETYDSSLIPQTQSKNNLSF
MKTNSIPYQNRIELPKDISTSPVSSQAVWHLTNSSEKGIDSTNALPRNDGTEALEIKIVE
KEEKNMLDESKTDSSMLIQISQMTLKGITKERQQTWENGTSEKHILHDASSAEETITAKD
LSITSSHETQNRILCSEVDPEINSNVHNFREVQNIQPDKDSAHKEGAMTVETHEALSFLP
GLKDSFEAENEVFLVPSRINEAENSAPKPVLYPPSAEYATTSPLETE
Download sequence
Identical sequences G3R721
ENSGGOP00000011147 ENSGGOP00000011147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]