SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011344 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011344
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily L domain-like 3.33e-29
Family U2A'-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011344   Gene: ENSGGOG00000011631   Transcript: ENSGGOT00000011674
Sequence length 251
Comment pep:novel chromosome:gorGor3.1:9:80063437:80095203:1 gene:ENSGGOG00000011631 transcript:ENSGGOT00000011674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEISTYDRN
YQENRGGKASRSLGAVNADCDSGGIITQEKVSEEEEEFGLEEDEDEDEDEEEEESGKGEK
RKRETDDEEDG
Download sequence
Identical sequences ENSGGOP00000020930 ENSGGOP00000011344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]