SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011479 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011479
Domain Number 1 Region: 56-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000746
Family HLH, helix-loop-helix DNA-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011479   Gene: ENSGGOG00000011764   Transcript: ENSGGOT00000011812
Sequence length 387
Comment pep:novel chromosome:gorGor3.1:5:161893435:161898136:-1 gene:ENSGGOG00000011764 transcript:ENSGGOT00000011812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQGECPEAEGLCGP
RGKPGLLTRPLPAQRSWRWMWRAWCLGVRPSCCGASSPARSTATRTAAAPGYDVPHPGRA
SALYSCQAHLPGRSPPQAFRAARSHLLEWTKRTLVWEQVLPKHPAAGCQAGPLEGKGQDS
SGPPWTPAGQAAWAAQAFGSAAPKGTGSLLGLFPSWTRPPAFASRKLYSIFIKSLFHNFP
SIVLPNENGGTPNHRPTGRGNNISSHH
Download sequence
Identical sequences G3R7Y1
ENSGGOP00000011479 ENSGGOP00000011479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]