SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011575 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011575
Domain Number 1 Region: 691-987
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.8e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011575   Gene: ENSGGOG00000011854   Transcript: ENSGGOT00000011910
Sequence length 992
Comment pep:novel chromosome:gorGor3.1:2b:108250722:108270000:-1 gene:ENSGGOG00000011854 transcript:ENSGGOT00000011910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRPGSERPELGRMRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLC
SHLEVCIQDGLFGQCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVIS
QEMERIPRLRPPEPRPRDRSGLAPKRPGPAEELLLQDIPTGSAPAAQHRLPQPPVGKGGA
GASSSLSPLQAELLPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSP
GMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPA
PSRARVPRLPEQGGSSRAEDSPEGYEKEGLEGHGEKPASPAVQPDAALQRLAAVLAGYGV
ELRQLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTPP
MPGHPTASPTSSEVQQVPSPVSSEPPKAARPPATPVLLEKKSPLGQSQPTVAGQLSARPA
AEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSL
ADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPRTAHSTSPMRSVLLTLVALAGV
AGLLVALAVALCVRQHARQRDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEG
PPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRD
RLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINA
SPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDE
GASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPL
LDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRD
QRPGLVRSKDQFEFALTAVAEEVNAILKALPQ
Download sequence
Identical sequences ENSGGOP00000011575 ENSGGOP00000011575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]