SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011743 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000011743
Domain Number - Region: 115-179
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00837
Family Intermediate filament protein, coiled coil region 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011743   Gene: ENSGGOG00000012017   Transcript: ENSGGOT00000012083
Sequence length 1091
Comment pep:novel chromosome:gorGor3.1:9:15849363:16223989:1 gene:ENSGGOG00000012017 transcript:ENSGGOT00000012083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLNTSSNGTGDTQRLKNASLDVKQILKNETELDITDNLRKKLHWAKKEKLEITTKHNAE
LASYESQIAKLRSEVEKGEALRQSLEYDLAIARKEAGLGRRAAEERLAEAHRIQEKLCAQ
NSELQAKTNETEKVFQTSQQKWKEECRRFEHDLEERDNMIQNCNREYDLLMKEKSRLEKT
LQEALEKHQREKNEMESHIRETALEEFRLQEEQWEAERRELQFIVQEQDTAVQNMHKKVE
KLETEHMDCSDLLRRQTSELEFSTQREERLRKEFEATILRVRKLEENIEAERAAHLESKF
NSEIIQLRIRDLEGALQVEKASQAEAVADLEIIKNEFKEVESAYEREKHNAQESFAKLNL
LEKEYFSKNKKLNEDIEEQKKVIIDLSKRLQYNEKSCSELQEELVMAKKHQAFLVETYEN
NVKELESILDSFTVLGQWTSGIHKDKDKPPSFCVVLETLRRTLTDYQNKLEDASNEEKAC
NELDSTKQKIDSHTKNIKELQDKLADVNKELSHLRTKCADREALISTLKVELQNVLHCWE
KEKAQAAQSESELQKLSQAFHKDAEEKLTFLHTLYQHLVAGCVLIKQPEGMLDKFSWSEL
CAVLQENVDALIADLNRANEKIRHLEYICKNKSDTMRELQQTQEDTFTKVAEQIKAQESC
WHKQKKELELQYSELFLEVQKRAQKFQEIAEKNMEKLNHIEKSHEQLVLENSHFKKLLSQ
TQREQMSLLAACALMAGALYPLYSRSCALSTQRDFLQEQVNTFELFKLEIRTLAQALSTV
EEKKQEEAKMKKKTFKGLIRIFRKGVIAILAANRLKILGQSCASLFTWMESFKEGIGMLV
CTGEPKDKHKFPKHQKEQLRCLQALSWLTSSDLLAAIISSMAELQDVIGKTEDANSRICG
HLLIGAAKNSFAKLMDKISLVMECIPLHSSRSITYVEKDSLVQRLAHGLHKVNTLALKYG
LRGHVPITKSTASLQKQILGFTQRLHAAEVERRSLRLEVTEFKRSVNEMKKELDKAQGLQ
MQLNEFKQSKLITHEKFESACEELNNALLREQQAQMLLNEQAQQLQELNYRLELHSSEEA
DKNQTLGEAVK
Download sequence
Identical sequences ENSGGOP00000011743 ENSGGOP00000011743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]