SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011807 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011807
Domain Number 1 Region: 900-1091
Classification Level Classification E-value
Superfamily Bet v1-like 5.63e-51
Family STAR domain 0.000000698
Further Details:      
 
Domain Number 2 Region: 659-860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 
Domain Number 3 Region: 22-92
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.87e-29
Family Variant SAM domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011807   Gene: ENSGGOG00000012096   Transcript: ENSGGOT00000012148
Sequence length 1103
Comment pep:novel chromosome:gorGor3.1:X:65802526:65881290:1 gene:ENSGGOG00000012096 transcript:ENSGGOT00000012148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLDVFWSCFRKVKCFPLLQVKKNAEAEAKRACEWLRATGFPQYVQLFEEGSFPLDIGS
VKKNHGFLDEDSLGALCRRLMTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHWAFQQE
SKCWSPMGSSDLLAPPSPGLPVTSSCESVLTELSATSLPVITVSLPPEPADLPLPGRAPS
SSDRPLLSPTQGQEGPQDKAKKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKAS
KASSFRSCRGFLSAGFYRAKNWAATSAGGSGANTRKAWEAWPVASFRHPQWTHRGDCLVH
VPGDHKPGTFPRSLSIESLCPEDGHRLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPE
LYPAEPVMVGAEAEDEDDEESGGSYAHLDDILQHVWGLQQRVELWSRAMYPDLGPGDEEE
EEATSSVEIATVEVKCQAEALSQMEVPARGESPAWAQAEVQPAVLALAQAPAEAEPLAQE
EAEAPAPAPAPAPAQDSEQEAHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNE
AEAAGPLAGLQASMPRERRDSGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEINRQFAG
QINLLHKGSLLRLTAFMEKYTVPHKQGWVWSMPKFMRRNKTPDYRGQHVFGVPPLIHVQR
TGQPLPQSIQQAMRYLRSQCLDQVGIFRKSGVKSRIQNLRQMNETSPDNVCYEGQSAYDV
ADLLKQYFRDLPEPIFTSKLTTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLY
FLSDIASAEENQMTAGNLAVCLAPSIFHLNVSKKDNPSPRIKSKRSLIGRPGPRDLSDNM
AATQGLSHMISDCKKLFQVPQDMVLQLCSSYSAAELSPPGPALAELRQAQAAGVSLSLYM
EENIQDLLRDAAERFKGWMSVPGPQHTELACRKAPDGHPLRLWKASTEVAAPPAVVLHRV
LRERALWDEDLLRAQVLEALMPGVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGGCLLV
SQSLDPEQPVPESGVRALMLTSQYLMEPCGLGRSRLTHICRADLRGRSPDWYNKVFGHLC
AMEVAKIRDSFPTLQAAGPETKL
Download sequence
Identical sequences G3S2M8
ENSGGOP00000011807 ENSGGOP00000011807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]