SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011878 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011878
Domain Number 1 Region: 1343-1409
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-20
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 670-737
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1517-1578
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1124-1250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.32e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 872-998
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000306
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 6 Region: 1004-1123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000013
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 550-620
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000275
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 8 Region: 1243-1296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000623
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 616-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1620-1706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000137
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1461-1506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 1421-1470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 401-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000082
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011878
Domain Number - Region: 188-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000289
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1288-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011878   Gene: ENSGGOG00000012159   Transcript: ENSGGOT00000012219
Sequence length 1720
Comment pep:novel chromosome:gorGor3.1:2a:33564763:34029648:1 gene:ENSGGOG00000012159 transcript:ENSGGOT00000012219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAWLRWGLLLWAGLLASSAHGRVRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNA
RYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPEPARPAAPGGQLHPKP
GGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKAPG
SQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAASSW
GPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVMIHHG
QTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSICK
VTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCP
PNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNI
VNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQ
VIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPS
YHGYNQMMECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTF
SSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGT
AAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVE
ALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGVSTIHLHPQFPGIV
IEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICY
EGYKFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDEC
LRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQ
CVPCTEGFRGWNGQCLDVDECLEPNVCTNGDCSNLEGSYMCSCHKGYTRTPDHKHCKDID
ECQQGNLCVNGQCRNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGS
FQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQ
DINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFCD
NTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYS
PMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWG
DNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFC
LNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDA
SEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQ
CALCPMKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQ
AEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKC
INTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences ENSGGOP00000011878 ENSGGOP00000011878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]