SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011939 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011939
Domain Number 1 Region: 6-56
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000773
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 119-238
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000863
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011939   Gene: ENSGGOG00000012232   Transcript: ENSGGOT00000012282
Sequence length 469
Comment pep:novel chromosome:gorGor3.1:3:51120080:51148598:-1 gene:ENSGGOG00000012232 transcript:ENSGGOT00000012282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIIN
KLFFDLAQEEENVLDAEFLKNELDNIRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVS
LQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEV
EEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVY
SELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNLPPVASETVDRLVLESPAPVE
VNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYSKKLCLEKSHSPIQGVPKKICKGP
RKESQLSLGGQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGL
GGRTKFIQATDTVMIRPLPVKPKTKAKQRVRVKTVPSLSQAKLDTFLWS
Download sequence
Identical sequences G3R959
ENSGGOP00000011939 XP_004034212.1.27298 ENSGGOP00000011939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]