SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011949 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011949
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-22
Family SH2 domain 0.00057
Further Details:      
 
Domain Number 2 Region: 271-448
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-16
Family Ras GEF 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011949   Gene: ENSGGOG00000012243   Transcript: ENSGGOT00000012292
Sequence length 576
Comment pep:novel chromosome:gorGor3.1:19:6946957:6962017:-1 gene:ENSGGOG00000012243 transcript:ENSGGOT00000012292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPQDGEDLAGQPWYHGLLSRQKAEALLQQDGDFLVRASGSRGGNPVISCRWRGSALHF
EVFRVALRPRPGRPTALFQLEDEQFPSIPALVHSYMTGRRPLSQATGAVVSRPVTWQGPL
RRSFSEDTLMDGPARIEPLRARKWSNSQPADLAHMGRSREDPTGMRASTMPISALPRTSS
DPVLLKAPAPLGTVANSLRASDGQLQAKAPTKPPRTPSFELPDASERPPTYCELVPRVPS
VQGTSPSQSSPEPEAPWWEAEEDEEEENRCFTRPQAEISFCPHDAPSCLLGPQNRPLEPQ
VLHTLRGLFLEHHPGSTALHLLLVDCQATGLLGVTRDQRGNMGVSSGLELLTLPHGHHLR
LELLERHQTLALAGALAVLGCSGPLEERAAALRGLVELALALRPGAVGDLPGLAAVMGAL
LMPQVSRLEHTWRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRL
LEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFV
RRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPDR
Download sequence
Identical sequences ENSGGOP00000011949 ENSGGOP00000011949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]