SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011951 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011951
Domain Number 1 Region: 131-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 80-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000917
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011951   Gene: ENSGGOG00000012249   Transcript: ENSGGOT00000012294
Sequence length 252
Comment pep:novel chromosome:gorGor3.1:1:186995950:187093546:1 gene:ENSGGOG00000012249 transcript:ENSGGOT00000012294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKT
LFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQ
CLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCV
DGEWSSALPVCKLIQEAPKPECEKALLAFQESKDLCEAMENFMQQLKESGMTMEELKYSL
ELKKAELKAKLL
Download sequence
Identical sequences ENSGGOP00000011951 XP_003822949.1.60992 XP_008974758.1.60992 ENSGGOP00000011951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]