SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011976 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011976
Domain Number 1 Region: 43-522
Classification Level Classification E-value
Superfamily Sema domain 4.19e-115
Family Sema domain 0.00000247
Further Details:      
 
Domain Number 2 Region: 1086-1345
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-75
Family Protein kinases, catalytic subunit 0.0000000176
Further Details:      
 
Domain Number 3 Region: 681-769
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 4 Region: 522-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000034
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 566-621
Classification Level Classification E-value
Superfamily E set domains 0.000000153
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 6 Region: 767-862
Classification Level Classification E-value
Superfamily E set domains 0.000000311
Family Other IPT/TIG domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011976   Gene: ENSGGOG00000012260   Transcript: ENSGGOT00000012320
Sequence length 1401
Comment pep:novel chromosome:gorGor3.1:3:51178004:51195124:-1 gene:ENSGGOG00000012260 transcript:ENSGGOT00000012320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLPPLPQSFLLLLLLPAKLAAGEDWQCPRTPYAASRDFDMKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLNC
RFAPKRRRRGAPEGGQSYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQLPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELARSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIRGPGCRHFLTCGRCLSAW
RFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRQCERQLPEQQLCRLPEYVVRDPQGWVA
GNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVT
VGGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLL
GILLPLLLLVAALATALVFSYWWRRKQLVLPLNLNDLASLDQTAGAIPLPILYSGSDYRS
GLALPAIDGLDSTTCVHGASFSDSKDESCVPLLRKESIQLRDLDSALLVEVKDVLIPHER
VVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLN
HPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYL
AEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDKEYYSVRQHRHARLPVKWMALESL
QTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQV
MQQCWEADPAVRPTFGVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQ
SSPMPGNVRRPRPLSEPPRPT
Download sequence
Identical sequences ENSGGOP00000011976 ENSGGOP00000011976 XP_018880109.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]