SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012058 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012058
Domain Number 1 Region: 351-474
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 185-265
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.000000152
Family ATP sulfurylase catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012058   Gene: ENSGGOG00000012356   Transcript: ENSGGOT00000012403
Sequence length 480
Comment pep:novel chromosome:gorGor3.1:15:23910552:23945204:-1 gene:ENSGGOG00000012356 transcript:ENSGGOT00000012403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAQSLSDAHHALAIMLSERLWLGLELLNFSRRKISSDPPPYNFLEAREAALGHRWRMQQ
EGGPVRSAPCRTGTLEGSRQGSPGHRKRASPKGSLSSAQPHSWMLTPSPLNSHCAHRESI
SSSPQPVANGSKQKKKSNWRSTTRLRVIRLRDRLEPRPLAILEDYADPFDVQETDEGSAG
ASGAPEKVPENDGYMEPYEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATPEGEGGP
WPRESRLPEDDERPPEEYDQPWEWKKERISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPD
GDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGREEKGRLPPRLSAGNPKSAKPLSME
PSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLKS
SQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Download sequence
Identical sequences ENSGGOP00000012058 ENSGGOP00000012058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]