SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012375 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012375
Domain Number 1 Region: 90-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-48
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012375   Gene: ENSGGOG00000012682   Transcript: ENSGGOT00000012732
Sequence length 274
Comment pep:novel chromosome:gorGor3.1:5:55739927:55742560:1 gene:ENSGGOG00000012682 transcript:ENSGGOT00000012732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRG
HHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGT
VLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLWDSWQGKRHL
FIMCSYCSTDLYSLWLAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDER
GHLKLTDFGLSRHVPQGARAYTICGTLQYMGERG
Download sequence
Identical sequences ENSGGOP00000012375 ENSGGOP00000012375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]