SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012424 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012424
Domain Number 1 Region: 243-345
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.29e-36
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000958
Further Details:      
 
Domain Number 2 Region: 1-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.08e-27
Family G proteins 0.0000072
Further Details:      
 
Domain Number 3 Region: 145-238
Classification Level Classification E-value
Superfamily Translation proteins 2.59e-20
Family Elongation factors 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012424   Gene: ENSGGOG00000012745   Transcript: ENSGGOT00000012784
Sequence length 366
Comment pep:novel chromosome:gorGor3.1:X:83323492:83324620:-1 gene:ENSGGOG00000012745 transcript:ENSGGOT00000012784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKNVITGTSQIDCAVLIVAAGVGEFEAGISKNGQTSEHALLAYTLDVKQLIVGVNKMNST
EPPCSQKRYEEIIKEVSTYIKKIGYNPNTVAFVPISGWNDDNMLEPTANVPSFEGWKVTC
KDGNDSGTTLLEALDYILQPSGPTDKPLRLPLQDVHKIGGIGTVLGGQVKTGVLKPGTVV
TFAAVDVTTEIKSVEMHQEALSEINFIPGNNVGFNIKNVSVKDVHGGNIAGDSKNGPPMK
AAGITAQVIILNHPGQISAGYTPVLDCHMAHTACKFAVLKEKIDHHSGKKLEDGSKFLKS
GDAAIIDMVPGNLMCIESFSDYPPLGHFGVCDMRQTVAVGVIKAVDQKDAGAGKVTKSAQ
KAQKAK
Download sequence
Identical sequences ENSGGOP00000012424 ENSGGOP00000012424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]